stationary phase is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-02-18. Numbers and descriptions here follow the published literature rather than marketing material.
Reversed-phase chromatography dominates modern HPLC testing, using a nonpolar stationary phase such as chemically bonded octadecyl groups and a polar mobile phase of water mixed with organic solvent. Analytes partition between the mobile and stationary phases according to hydrophobicity. Gradient elution changes the mobile phase composition over time to separate compounds with a wide range of retention. Isocratic elution keeps the composition constant and is simpler for routine assays. Column temperature, pH, and flow rate influence selectivity, peak shape, and retention time, so these parameters are controlled during a validated method.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. A diode array detector records full spectra across a wavelength range, which helps identify co-eluting peaks. Mass spectrometry provides mass-to-charge ratios and can confirm molecular identity at low concentrations. The choice of detector depends on analyte structure, required sensitivity, and whether quantitation or identification is the goal. No single detector works for every compound, and method development often compares responses before selecting one.
Data handling and documentation are central to HPLC quality control. Electronic systems should have audit trails that record changes to methods, sequences, and results. Integration parameters, such as peak baseline and threshold, can affect reported areas and must be defined in advance. Out-of-specification results trigger a structured investigation that may include reanalysis, instrument checks, and review of sample preparation. Regulatory inspections often examine raw data, audit trails, and training records to verify that reported results are traceable and reliable.
Method validation establishes that an HPLC procedure is suitable for its intended use. Key parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Accuracy measures agreement with a true or accepted value, while precision describes repeatability and intermediate precision. Specificity confirms that the method measures the analyte without interference from impurities, degradants, or excipients. Validation is documented in a protocol and report, and acceptance criteria are set before experiments begin. Regulatory guidance varies by region, but the general principles are widely harmonized.
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Common checks include retention time, peak area, resolution between critical pairs, tailing factor, and theoretical plate count. Results are compared with predefined limits, and a failed check requires investigation before sample results are reported. Quality control samples at low, middle, and high concentrations are injected at intervals to monitor accuracy and precision. Blank injections detect carryover and contamination, while control charts track performance over time.
| Property | Value | Notes |
|---|---|---|
| Separation mode | Reversed-phase | Most common for neutral and moderately polar analytes |
| Column particle size | 3–5 µm | Smaller particles improve resolution but raise backpressure |
| Mobile phase pH range | 2–8 | Silica-based columns may degrade outside this range |
| Typical flow rate | 1.0–2.0 mL/min | For analytical columns with 4.6 mm internal diameter |
| Common synonyms | HPLC, LC, high-pressure liquid chromatography | High-performance liquid chromatography is the standard expansion |
Routine HPLC testing compares a sample result with a calibration curve prepared from known reference standards. Peak area or peak height is plotted against concentration, and the curve is used to estimate unknown amounts. Retention time supports tentative identification when compared with a standard, though mass spectrometry or another confirmatory method may be needed for definitive identification. Pre-run checks verify repeatability, resolution, and peak symmetry before sample analysis. Limits of detection and quantification describe the smallest amounts that can be reliably observed or measured. Sample preparation, filtration, and degassing help prevent column damage and inconsistent results.
High-performance liquid chromatography is an analytical technique that separates components in a liquid sample. A pump moves a liquid mobile phase through a column packed with a solid stationary phase. Compounds interact differently with both phases and travel at different rates, leaving the column at distinct retention times. A detector records these arrivals as peaks on a chromatogram. The resulting pattern supports identification and quantification of substances in mixtures. Modern instruments use high pressure to force solvent through small particles, which improves speed and resolution compared with older low-pressure liquid chromatography methods.
Regulatory and pharmacopeial texts shape how HPLC testing is performed and documented. The International Council for Harmonisation provides validation guidance, while pharmacopeias publish general chromatography chapters and monographs for specific materials. Accreditation standards such as ISO/IEC 17025 address laboratory competence and traceability. Inspectors may review instrument qualification, analyst training, reference material control, and electronic records. Open questions include how best to validate methods for new complex products and how to handle automated data processing. Laboratories generally resolve these issues through risk assessment, method lifecycle management, and documented scientific justification.
In quality control laboratories, HPLC testing supports batch release, raw material checks, stability studies, and impurity profiling. A validated method defines sample preparation, instrument settings, calibration, and acceptance criteria. Analysts compare results with specifications and investigate out-of-specification outcomes before a batch is approved. Documentation includes chromatograms, integration records, audit trails, and reagent details. Because results influence product decisions, laboratories follow formal quality systems and data integrity rules. The exact tests and limits depend on the material, its intended use, and the applicable regulatory framework.
Method validation examines whether an HPLC procedure is suitable for its intended purpose. Common parameters include accuracy, precision, specificity, linearity, range, detection limit, quantification limit, and robustness. Accuracy describes closeness to a true or accepted value, while precision describes agreement among repeated measurements. Specificity shows whether the method can measure the analyte without interference from related substances. Robustness tests small deliberate changes in flow, temperature, or solvent composition. Validation is not a one-time event; methods may need partial revalidation after changes to instruments, columns, sample handling, or specification limits. Regulatory guidance provides frameworks, but some details remain method-specific.
The binding of S-arrestin to rhodopsin is specific and involves changes that occur in rhodopsin after activation. Important serine (Ser) and threonine (Thr) residues in rhodopsin's tail, particularly Thr-340 and Ser-343, are phosphorylated by enzymes called GRKs. These phosphorylated residues strongly attract S-arrestin, helping it bind tightly and effectively shut down rhodopsin's signaling. Additionally, studies of the protein structure have shown that during activation, rhodopsin's transmembrane helix 7 (TM7) and helix 8 change shape. These changes expose a binding site that interacts with a specific part of arrestin called the "finger loop." This interaction, clearly seen in the crystal structure (PDB ID: 4ZWJ), shows how arrestin fits precisely onto activated and phosphorylated rhodopsin, efficiently stopping the visual signal. Arrestin at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
Camurus' FluidCrystal are available as injectable depots and topical bioadhesive delivery technologies. By encapsulating the drug compound in the nanostructures, injectable depots are able to deliver therapeutic levels of drug substance over extended periods from a single injection. This leads to a decrease in traditional side effects associated with high initial drug release on injection (drug burst), poor drug stability, and complex processing requirements, making the system highly suitable for sustained parental delivery of peptides, proteins, and small molecule drug compounds. The topical delivery system creates a bio-adhesive film that provides local and continual release of drug compounds. The delivery system is suited for delivery of peptide, protein, and small molecule drug compounds and can be applied to dermal, buccal, ophthalmic, nasal, vaginal, and other topical surfaces.
CPC Scientific Group was founded in 2001, and the US company established in 2005 by Shawn Lee, Ph.D., and began by supplying research-grade custom peptides, catalog peptides, and Fmoc-protected amino acids. In 2006, the company opened a GMP (Good Manufacturing Practice) facility in Hangzhou, China to support the production of peptides for clinical use. The Hangzhou site underwent its first inspection by the U.S. Food and Drug Administration (FDA) in 2011, after which CPC Scientific began supplying pharmaceutical-grade peptides to clients in the United States. On March 17, 2016, the company passed a fourth FDA inspection. In 2024, the company completed a fifth U.S. FDA inspection and was also inspected by Australia’s Therapeutic Goods Administration (TGA). In 2025, CPC Scientific obtained ISO 22716:2007 Cosmetic GMP certification for the manufacture of peptide ingredients for cosmetic applications. CPC Scientific is part of Medtide Inc., which was listed on the Main Board of the Hong Kong Stock Exchange on June 30, 2025 (Stock Code: 03880).
RCO2H + R'2NH → RCO−2 + R'2NH+2 RCO−2 + R'2NH+2 → RC(O)NR'2 + H2O Esters are far superior substrates relative to carboxylic acids. Further "activating" both acid chlorides (Schotten-Baumann reaction) and anhydrides (Lumière–Barbier method) react with amines to give amides: RCO2R" + R'2NH → RC(O)NR'2 + R"OH RCOCl + 2R'2NH → RC(O)NR'2 + R'2NH+2Cl− (RCO)2O + R'2NH → RC(O)NR'2 + RCO2H Peptide synthesis use coupling agents such as HATU, HOBt, or PyBOP. The hydrolysis of nitriles is conducted on an industrial scale to produce fatty amides. Laboratory procedures are also available. Many specialized methods also yield amides. A variety of reagents, e.g. tris(2,2,2-trifluoroethyl) borate have been developed for specialized applications. Amidogen Amino radical Imidic acid Metal amides IUPAC Compendium of Chemical Terminology
Adenosine triphosphate (ATP) is a nucleoside triphosphate that provides free energy of approximately 58 kJ/mol (0.6 eV) to drive and support many processes in living cells, such as muscle contraction, nerve impulse propagation, and chemical synthesis. Found in all known forms of life, it is often referred to as the "molecular unit of currency" for intracellular energy transfer. When consumed in a metabolic process, ATP converts either to adenosine diphosphate (ADP) or to adenosine monophosphate (AMP). Other processes, such as oxidative phosphorylation or substrate-level phosphorylation, regenerate ATP. ATP is also a precursor to DNA and RNA, and is used as a coenzyme. Daily, an average adult human recycles through synthesis and hydrolysis around 50 kilograms of ATP (about 100 moles). From the perspective of biochemistry, ATP is classified as a nucleoside triphosphate, which indicates that it consists of three components: a nitrogenous base (adenine), the sugar ribose, and the triphosphate.
Sources: en.wikipedia.org
ALK-negative ALCL tumor cells show products made by chimeric genes: DUSP22-IRF4 (many of which are fused at particular site and termed DUSP22-FRA7H) in 30% of the cases; TP63-TBL1XR1 in 8% of cases; and NFKB2-ROS1, NCOR2-ROS1, NFKB2-TYK2, or PABPC4-TYK2 in rare cases. They also show mutations in the JAK1 and/or STAT3 genes in 18% of cases; the MSC gene in 15% of cases, and the NOTCH1 gene in 15% of cases. About 24% of cases have a truncated ERBB4 gene. DUSP22 gene rearrangements have been associated with favorable outcomes in ALK-negative ALCL while TP63 gene arrangements are often associated with a poorer prognosis in various cancers. ALK-negative ALCL cells overexpress overactive STAT3 in 47% of cases and JAK1 in many cases. Many of these gene abnormalities appear to contribute to the development of ALK-negative ALCL.
Individual transmembrane adenylyl cyclase isoforms have been linked to numerous physiological functions. Soluble adenylyl cyclase (sAC, AC10) has a critical role in sperm motility. Adenylyl cyclase has been implicated in memory formation, functioning as a coincidence detector. AC-IV was first reported in the bacterium Aeromonas hydrophila, and the structure of the AC-IV from Yersinia pestis has been reported. These are the smallest of the AC enzyme classes; the AC-IV (CyaB) from Yersinia is a dimer of 19 kDa subunits with no known regulatory components (PDB: 2FJT). AC-IV forms a superfamily with mammalian thiamine-triphosphatase called CYTH (CyaB, thiamine triphosphatase). These forms of AC have been reported in specific bacteria (Prevotella ruminicola O68902 and Rhizobium etli Q8KY20, respectively) and have not been extensively characterized. There are a few extra members (~400 in Pfam) known to be in class VI. Class VI enzymes possess a catalytic core similar to the one in Class III.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Genetically modified organism History of biotechnology An Asilomar Moment Archived 10 July 2013 at the Wayback Machine Original Asilomar Genetics Guidelines “Asilomar Conference.” Provides another summary of the Asilomar Conference. The Basics of Recombinant DNA provides an introduction to the science behind recombinant DNA. The Recombinant DNA Debate Archived 31 March 2007 at the Wayback Machine provides more details about the history of the debate surrounding the use of recombinant DNA technology. “Paul Berg: The 1980 Nobel Prize in Chemistry – Autobiography.” Provides an autobiography about Paul Berg. Science History Institute: The story of the 1975 Asilomar Conference on Recombinant DNA
The AlphaFold Protein Structure Database (AlphaFold DB) is a collaborative project with Google DeepMind to make predicted protein structures from the AlphaFold AI system freely available to the scientific community. The first release of the database was in 2021; as of 2024, AlphaFold DB provides access to over 214 million protein structures. National Center for Biotechnology Information (NCBI), United States National Library of Medicine National Institute of Genetics (DNA Data Bank of Japan) Swiss Institute of Bioinformatics (SIB: Expasy) Australia Bioinformatics Resource BIG Data Center (National Genomics Data Center), Beijing Institute of Genomics, Chinese Academy of Sciences Alternative splicing and transcript diversity database BioJS - open-source project for bioinformatics data on the web BioSamples European Molecular Biology Organization European Nucleotide Archive
Sources: en.wikipedia.org
Adrenomedullin (ADM) is a peptide hormone that plays an important role in various physiological processes throughout the human body. Initially discovered in 1993 from a pheochromocytoma, a tumor of the adrenal medulla, this 52-amino acid peptide is now recognized for its diverse effects, including vasodilation, regulation of blood pressure, and maintenance of the vascular system. ADM is widely expressed in tissues and also found in the circulation, exerting its influence on the cardiovascular, lymphatic, and endocrine systems, as well as demonstrating anti-inflammatory and tissue-protective properties. In humans, ADM is encoded by the ADM gene. A similar peptide named adreomedullin2 was reported in rats in 2004, which exhibits a similar function.
Acid–base extraction is a subclass of liquid–liquid extractions and involves the separation of chemical species from other acidic or basic compounds. It is typically performed during the work-up step following a chemical synthesis to purify crude compounds and results in the product being largely free of acidic or basic impurities. A separatory funnel is commonly used to perform an acid-base extraction. Acid-base extraction utilizes the difference in solubility of a compound in its acid or base form to induce separation. Typically, the desired compound is changed into its charged acid or base form, causing it to become soluble in aqueous solution and thus be extracted from the non-aqueous (organic) layer. Acid-base extraction is a simple alternative to more complex methods like chromatography. It is not possible to separate chemically similar acids or bases using this simple method.
Two additional amino acids are in some species coded for by codons that are usually interpreted as stop codons: In addition to the specific amino acid codes, placeholders are used in cases where chemical or crystallographic analysis of a peptide or protein cannot conclusively determine the identity of a residue. They are also used to summarize conserved protein sequence motifs. The use of single letters to indicate sets of similar residues is similar to the use of abbreviation codes for degenerate bases.
These drugs have been derived from NSAIDs. The cyclooxygenase enzyme inhibited by NSAIDs was discovered to have at least two different versions: COX-1 and COX-2. Research suggested most of the adverse effects of NSAdiated by blocking the COX-1 (constitutive) enzyme, with the analgesic effects being mediated by the COX-2 (inducible) enzyme. Thus, the COX-2 inhibitors were developed to inhibit only the COX-2 enzyme (traditional NSAIDs block both versions in general). These drugs (e.g., rofecoxib, celecoxib, and etoricoxib) are equally effective analgesics when compared with NSAIDs, but cause less gastrointestinal hemorrhage in particular. After widespread adoption of the COX-2 inhibitors, it was discovered that most of the drugs in this class increase the risk of cardiovascular events by 40% on average. This led to the withdrawal of rofecoxib and valdecoxib, and warnings on others. Etoricoxib seems relatively safe, with the risk of thrombotic events similar to that of non-coxib NSAID diclofenac.
BLAST is an algorithm for comparing biomacromolecule primary structure, most often nucleotide sequence of DNA/RN, and amino acid sequence of proteins, stored in the bioinformatic databases, with the query sequence. The algorithm uses scoring of the available sequences against the query by a scoring matrix such as BLOSUM 62. The highest scoring sequences represent the closest relatives of the query, in terms of functional and evolutionary similarity. The database search by BLAST requires input data to be in a correct format (e.g. FASTA, GenBank, PIR or EMBL format). Users may also designate the specific databases to be searched, select scoring matrices to be used and other parameters prior to the tool run. The best hits in the BLAST results are ordered according to their calculated E-value (the probability of the presence of a similarly or higher-scoring hit in the database by chance).
Sources: en.wikipedia.org
HPLC testing separates and quantifies components in a liquid sample. It is used to check identity, purity, concentration, or stability. The technique works best for compounds that dissolve and are not easily vaporized.
The pump maintains a steady flow rate and pressure, which keeps retention times reproducible. Pulsation or flow errors can shift peaks and distort quantitation. Modern pumps use feedback control to reduce these variations.
HPLC alone usually separates compounds but does not always identify them. Retention time matching with a known standard provides tentative identification. Coupling HPLC to mass spectrometry adds mass information that supports structural identification.
System suitability is a set of checks that confirm the instrument and method perform within limits before sample analysis. It typically includes resolution, tailing factor, retention time, and peak area reproducibility. If a check fails, the run is invalidated until the cause is resolved.