reversed-phase is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-08-22. Where a claim depends on a specific study, the study is described rather than over-claimed.
Quality control samples are inserted at intervals to monitor accuracy and precision throughout a batch. Blank samples detect contamination, while spiked samples assess recovery from the sample matrix. Calibration standards establish the relationship between detector response and concentration, and control samples are prepared independently from them whenever possible. Laboratories also participate in proficiency testing and maintain audit trails, instrument logs, and reagent records. Ongoing review of control charts can reveal trends before they cause out-of-specification results.
Method validation demonstrates that an HPLC procedure is suitable for its intended purpose. Common validation parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantification, and robustness. Accuracy reflects agreement with a reference value, while precision describes repeatability under defined conditions. Specificity shows whether the method can measure the analyte in the presence of impurities or matrix components. Validation documents are reviewed before a method is used for routine testing or regulatory submissions.
Documentation and traceability are central to regulated HPLC testing. Records typically include instrument logs, column history, mobile-phase preparation, sample preparation, injection sequences, raw chromatograms, and audit trails. Electronic systems may require user access controls, time-stamped changes, and backup procedures. Training records show that analysts are qualified for assigned methods. Audits and inspections check whether written procedures match actual practice and whether deviations are documented. These controls support reproducibility and allow results to be reconstructed if questions arise later.
Method validation establishes that an HPLC procedure is suitable for its intended purpose. Typical parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, robustness, and solution stability. Accuracy reflects closeness to a reference value, while precision reflects agreement among repeated measurements. Specificity shows whether the method can measure the analyte without interference from matrix components. Validation is documented through protocols and reports, and the required extent depends on the method's use and regulatory context.
| Property | Value | Notes |
|---|---|---|
| Validation parameter | Accuracy | Closeness to a reference value. |
| Validation parameter | Precision | Repeatability or intermediate precision. |
| Validation parameter | Linearity | Proportional response across a range. |
| System suitability check | Resolution | Separation between adjacent peaks. |
| Quality control tool | Control chart | Tracks results over time for trends. |
Routine HPLC testing compares a sample result with a calibration curve prepared from known reference standards. Peak area or peak height is plotted against concentration, and the curve is used to estimate unknown amounts. Retention time supports tentative identification when compared with a standard, though mass spectrometry or another confirmatory method may be needed for definitive identification. Pre-run checks verify repeatability, resolution, and peak symmetry before sample analysis. Limits of detection and quantification describe the smallest amounts that can be reliably observed or measured. Sample preparation, filtration, and degassing help prevent column damage and inconsistent results.
High-performance liquid chromatography is an analytical technique that separates components in a liquid sample. A pump moves a liquid mobile phase through a column packed with a solid stationary phase. Compounds interact differently with both phases and travel at different rates, leaving the column at distinct retention times. A detector records these arrivals as peaks on a chromatogram. The resulting pattern supports identification and quantification of substances in mixtures. Modern instruments use high pressure to force solvent through small particles, which improves speed and resolution compared with older low-pressure liquid chromatography methods.
Separation in HPLC depends on the chemistry of the stationary phase, the composition of the mobile phase, and the physical properties of the column. Reverse-phase separations use a nonpolar stationary phase and a polar mobile phase, and they are common for many organic compounds. Ion-exchange, size-exclusion, and normal-phase modes serve other classes of analytes. Gradient elution changes solvent strength over time, while isocratic elution holds it constant. Flow rate, temperature, particle size, and column length all influence peak shape and resolution. Detection may use ultraviolet absorbance, fluorescence, refractive index, or mass spectrometry, depending on the analyte and the required sensitivity.
Laboratories apply HPLC testing across pharmaceutical, food, environmental, and industrial chemistry. The method can measure active ingredients, impurities, additives, preservatives, and degradation products. Sample preparation often includes dilution, filtration, and sometimes extraction or derivatization. The choice of column, mobile phase, pH, temperature, and detector depends on the analytes and matrix. Results are compared with reference standards to assign identity and concentration. Method suitability is judged by resolution, precision, and accuracy.
HPLC testing is not a single fixed procedure; it is a family of separation modes. Reversed-phase, normal-phase, ion-exchange, size-exclusion, and affinity chromatography each suit different analyte properties. Reversed-phase methods dominate because they handle many neutral and moderately polar compounds. Detection can be optical, electrochemical, or mass spectrometric, and the detector dictates what information is available. Coupling with mass spectrometry increases selectivity and enables identification when standards are unavailable. The technique cannot separate every mixture without adjustment.
HPLC testing is an analytical technique used to separate, identify, and quantify components in a liquid sample. It relies on a pressurized mobile phase that carries the sample through a column packed with stationary phase. Different compounds travel at different rates because of interactions with the stationary and mobile phases. The resulting signal versus time is a chromatogram. Peak position indicates identity under specified conditions, while peak area or height relates to amount.
Detection commonly uses ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. Ultraviolet detection depends on molecular chromophores that absorb light at specific wavelengths. Mass spectrometry provides mass information and sensitive quantification, often after electrospray ionization. Before sample batches, performance checks examine resolution, elution time repeatability, peak symmetry, and plate count. Matrix effects and co-elution remain recognized uncertainties; formal validation studies and orthogonal detection help address them. Detector choice depends on analyte properties and required sensitivity.
High-performance liquid chromatography, or HPLC, separates dissolved compounds by passing a liquid mobile phase through a packed column. Components distribute differently between the stationary phase and the moving liquid, so they travel at different speeds and exit at different times. A detector records these eluting bands as peaks, and peak area or height relates to amount. The technique supports testing in pharmaceuticals, foods, environmental samples, and industrial chemicals. Quantification usually depends on calibration with known standards.
Method validation demonstrates that an analytical procedure is suitable for its intended purpose. Typical validation characteristics include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Regulatory guidance from bodies such as the International Council for Harmonisation and the United States Pharmacopeia outlines expectations, though specific criteria depend on the product and method. System suitability tests are run before sample analysis to confirm resolution, peak symmetry, column efficiency, and injection repeatability. Failure of these checks can invalidate a batch of measurements.
Practical HPLC testing depends on careful sample preparation and instrument maintenance. Samples may require filtration, dilution, pH adjustment, or extraction to avoid column damage and matrix interference. Mobile phases are degassed and filtered, and columns are equilibrated before injection. Common problems include peak tailing, baseline drift, ghost peaks, carryover, and co-elution of analytes. Documentation of instrument logs, calibration records, and electronic audit trails supports data integrity and traceability. Ongoing training and routine maintenance help reduce variability between analysts and laboratories.
A balloon pops when the material that makes up its surface tears or shreds, creating a hole. Normally, there is a balance of the balloon skin's elastic tension in which every point on the balloon's surface is being pulled by the material surrounding it. However, if a hole is made on the balloon's surface, the force becomes imbalanced, since there is no longer any force exerted by the center of the hole on the material at its edge. As a result, the balloon's surface at the edge of the hole pulls away, making it bigger; the high pressure air can then escape through the hole and the balloon pops. A balloon can be popped by either physical or chemical actions. Limpanuparb et al. use popping a balloon as a demonstration to teach about physical and chemical hazards in laboratory safety.
PABA and its salts are used in nutritional epidemiological studies to assess the completeness of 24-hour urine collection for the determination of urinary sodium, potassium, or nitrogen levels. The potassium salt (potassium paraaminobenzoate, "aminobenzoate potassium") is used as a drug against fibrotic skin disorders, such as Peyronie's disease, under the brand name Potaba. There is a lack of strong evidence. It is believed to work by inhibiting fibroblast glycosaminoglycan secretion and stabilizing monoamine oxidase A activity. PABA is also occasionally used in pill form by sufferers of irritable bowel syndrome to treat its associated gastrointestinal symptoms. PABA derivatives have also been proposed to function as acetylcholinesterase inhibitors in diseases that cause deficient cholinergic systems, such as Alzheimer's disease.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
In 1961, Peter Mitchell proposed chemiosmosis as a cell's primary system of energy conversion. The mechanism, now ubiquitous in living cells, powers energy conversion in micro-organisms and in the mitochondria of eukaryotes, making it a likely candidate for early life. Mitochondria produce adenosine triphosphate (ATP), the energy currency of the cell used to drive cellular processes such as chemical syntheses. The mechanism of ATP synthesis involves a closed membrane in which the ATP synthase enzyme is embedded. The energy required to release strongly bound ATP has its origin in protons that move across the membrane. In modern cells, those proton movements are caused by the pumping of ions across the membrane, maintaining an electrochemical gradient. In the first organisms, the gradient could have been provided by the difference in chemical composition between the flow from a hydrothermal vent and the surrounding seawater, or perhaps meteoric quinones that were conducive to the development of chemiosmotic energy across lipid membranes if at a terrestrial origin.
Most commonly 2,5-diketopiperazines are generated by cyclisation of dipeptides. In addition to the many methods of peptide synthesis, the Ugi reaction can be applied. Dipeptides with an ester terminus spontaneously cyclize often. Racemization can be problematic. The Ugi reaction using an isonitrile, amino acid, aldehyde and amine, can produce a dipeptide in equally high yield and optical purity, to that formed by standard peptide couplings. Commonly, an isonitrile is chosen to give a labile terminal amide to enable cyclization. For example, the direct 2,5-DKP ring formation via such an activated leaving group using the stable, easily accessible and versatile convertible isonitrile 1-isocyano-2-(2,2-dimethoxyethyl)-benzene 4 gave a one-pot synthesis of N-substituted 2,5-diketopiperazine's 7.
Sources: en.wikipedia.org
Klibanski became chief of the Neuroendocrine Unit at Massachusetts General Hospital, studying hormones and neuroendocrinology with a focus on hypopituitarism and pituitary tumors. Her clinical research has also examined the effects of hypothalamic and pituitary disorders on body composition and bone density, including bone loss associated with anorexia nervosa and growth hormone deficiency. In 1997, Klibanski became the first woman from Mass General's Department of Medicine to become a professor of medicine at Harvard. She has authored more than 350 peer-reviewed papers and book chapters and has received the Endocrine Society Clinical Investigator Award and the Clinical Endocrinology Trust Medal from the Society for Endocrinology. Klibanski has served on the National Institute of Diabetes and Digestive and Kidney Diseases Board of Counselors and the editorial board of the Journal of Clinical Endocrinology and Metabolism, and is a past president of the Pituitary Society. She established the Center for Faculty Development at Massachusetts General Hospital and mentored more than fifty women, for which she received the Endocrine Society's Outstanding Mentor Award.
Five amino acids possess a charge at neutral pH. Often these side chains appear at the surfaces on proteins to enable their solubility in water, and side chains with opposite charges form important electrostatic contacts called salt bridges that maintain structures within a single protein or between interfacing proteins. Many proteins bind metal into their structures specifically, and these interactions are commonly mediated by charged side chains such as aspartate, glutamate and histidine. Under certain conditions, each ion-forming group can be charged, forming double salts. The two negatively charged amino acids at neutral pH are aspartate (Asp, D) and glutamate (Glu, E). The anionic carboxylate groups behave as Brønsted bases in most circumstances. Enzymes in very low pH environments, like the aspartic protease pepsin in mammalian stomachs, may have catalytic aspartate or glutamate residues that act as Brønsted acids.
BIA Separations was formed in 1998 by a group of scientists in Ljubljana, Slovenia to commercialize a new chromatographic resin based on monolith technology. Monolithic resin was developed independently by three different laboratories in late 1980s led by Hjertén, Švec and Tennikova. The company was one of the few Slovenian companies to receive venture capital funding at that time-Horizonte Venture Management realizing the potential of monoliths made the initial investment in the company. During that year, BIA Separations released its first commercial product marketed under the trade name of CIM (Convective Interaction Media). The new technique was named HPMC (High Performance Monolith Chromatography). During the 1999 and 2000s, the company promoted this new platform technology to the scientific and business community and registered several patents. In 2007 the company headquarters moved to Villach, Austria. In 2011 BIA Separations entered a strategic partnership with Japan Synthetic Rubber Corporation, a Japanese company producing synthetic materials. A strategic partnership agreement with Showa Denko K.K. (SDK) was signed in 2012.
Molecular biomarkers have been defined as biomarkers that can be discovered using basic and acceptable platforms such as genomics and proteomics. Many genomic and proteomics techniques are available for biomarker discovery and a few techniques that are recently being used can be found on that page. Apart from genomics and proteomics platforms biomarker assay techniques, metabolomics, lipidomics, glycomics, and secretomics are the most commonly used as techniques in identification of biomarkers. Biomarkers can be classified on their clinical applications as molecular biomarkers, cellular biomarkers or imaging biomarkers. Four of the main types of molecular biomarkers are genomic biomarkers, transcriptomic biomarkers, proteomic biomarkers and metabolic biomarkers.
Since the bacteriophage Phage Φ-X174 was sequenced in 1977, the DNA sequences of thousands of organisms have been decoded and stored in databases. This sequence information is analyzed to determine genes that encode proteins, RNA genes, regulatory sequences, structural motifs, and repetitive sequences. A comparison of genes within a species or between different species can show similarities between protein functions, or relations between species (the use of molecular systematics to construct phylogenetic trees). With the growing amount of data, it long ago became impractical to analyze DNA sequences manually. Computer programs such as BLAST are used routinely to search sequences—as of 2008, from more than 260,000 organisms, containing over 190 billion nucleotides. Before sequences can be analyzed, they are obtained from a data storage bank, such as GenBank. DNA sequencing is still a non-trivial problem as the raw data may be noisy or affected by weak signals. Algorithms have been developed for base calling for the various experimental approaches to DNA sequencing.
Sources: en.wikipedia.org
Casokinins and lactokinins, breakdown products of casein and whey, occur naturally after ingestion of milk products, especially cultured milk. Their role in blood pressure control is uncertain. The lactotripeptides Val-Pro-Pro and Ile-Pro-Pro produced by the probiotic Lactobacillus helveticus or derived from casein have been shown to have ACE-inhibiting and antihypertensive functions. In one study, L. helveticus PR4 was isolated from Italian cheeses.
Naturally occurring chitin and certain peptides have been recognized for their antimicrobial properties. Today, these materials are engineered into nanoparticles to produce low-cost disinfection applications. Natural peptides form nano-scale channels in the bacterial cell membranes, which causes osmotic collapse. These peptides are now synthesized to tailor the antimicrobial nanostructures with respect to size, morphology, coatings, derivatization, and other properties allowing them to be used for specific antimicrobial properties as desired. Chitosan is a polymer obtained from chitin in arthropod shells, and has been used for its antibacterial properties for a while, but even more so since the polymer has been made into nanoparticles. Chitosan proves to be effective against bacteria, viruses, and fungi, however, it is more effective against fungi and viruses than bacteria. The positively charged chitosan nanoparticles interact with the negatively charged cell membrane, which causes an increase in membrane permeability, and eventually the intracellular components leak and rupture.
A biomaterial should perform its intended function within the living body without negatively affecting other bodily tissues and organs. In order to prevent unwanted organ and tissue interactions, biomaterials should be non-toxic. The toxicity of a biomaterial refers to the substances that are emitted from the biomaterial while in vivo. A biomaterial should not give off anything to its environment unless it is intended to do so. Nontoxicity means that biomaterial is: noncarcinogenic, nonpyrogenic, hypoallergenic, blood compatible, and noninflammatory. However, a biomaterial can be designed to include toxicity for an intended purpose. For example, application of toxic biomaterial is studied during in vivo and in vitro cancer immunotherapy testing. Toxic biomaterials offer an opportunity to manipulate and control cancer cells. One recent study states: "Advanced nanobiomaterials, including liposomes, polymers, and silica, play a vital role in the codelivery of drugs and immunomodulators. These nanobiomaterial-based delivery systems could effectively promote antitumor immune responses and simultaneously reduce toxic adverse effects." This is a prime example of how the biocompatibility of a biomaterial can be altered to produce any desired function.
Cannabis Analytical Science Program (CASP) is a forum where the science of hemp and cannabis analysis can be discussed and cannabis standards and methods developed. Analytical Solutions Forum (ASF) brings global stakeholders together to identify emerging needs and technologies in scientific analysis of food and related products. === Botanical Ingredients and Dietary Supplement Integrity Program === AOAC’s Botanical Ingredient and Dietary Supplement Integrity (BIDSI) Program focuses on coordinating all future consensus-driven need for development, validation, and implementation of methods for the analysis of a wide range of botanical ingredients and dietary supplements. === Stakeholder Program on Infant Formula and Adult Nutritionals === Stakeholder Program on Infant Formula and Adult Nutritionals program (SPIFAN) develops consensus-based standards and methods to make infant formula and adult nutritionals safer for babies and adults to consume.
Sources: en.wikipedia.org
Method validation is the documented process of showing that an HPLC procedure produces reliable results for a defined purpose. It examines parameters such as accuracy, precision, specificity, linearity, and robustness. Regulators and quality systems often require validation before routine use.
System suitability is a set of checks run on the chromatographic system before sample analysis. It confirms that resolution, peak shape, retention time, and response meet predefined limits. Failure can invalidate the run and trigger corrective action.
Blank injections reveal peaks or baseline disturbances that come from solvents, reagents, or the instrument rather than the sample. They help distinguish contamination from actual analyte signals. Comparing blanks with sample runs supports accurate interpretation.
Validation establishes suitability for a new method, while verification confirms that a method works in a specific laboratory. Verification is often used when a validated method is adopted with existing equipment and staff. Both rely on documented acceptance criteria.